PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19065.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 340aa    MW: 38256 Da    PI: 6.6261
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19065.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT++Ede+lv+++++  g+ +W++ +++ g+ R++k+c++rw +yl
  mrna19065.1-v1.0-hybrid 14 RGPWTPDEDEILVNYINKNKGHgSWRSLPQHAGLLRCGKSCRLRWTNYL 62
                             89*****************9999**********99************97 PP

2Myb_DNA-binding52.11.5e-1668113148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+eE++l+++++ +lG++ W++Ia+ ++ gRt++++k+ w+++l
  mrna19065.1-v1.0-hybrid  68 RGPFTEEEEKLIIQLHGMLGNR-WAAIASQLP-GRTDNEIKNLWNTHL 113
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-22565IPR009057Homeodomain-like
PROSITE profilePS5129415.047962IPR017930Myb domain
SuperFamilySSF466891.14E-2811109IPR009057Homeodomain-like
SMARTSM007174.8E-111364IPR001005SANT/Myb domain
PfamPF002493.0E-141462IPR001005SANT/Myb domain
CDDcd001673.84E-91662No hitNo description
PROSITE profilePS5129426.06763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2666118IPR009057Homeodomain-like
SMARTSM007171.8E-1567115IPR001005SANT/Myb domain
PfamPF002498.4E-1668113IPR001005SANT/Myb domain
CDDcd001671.88E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRTPCCDKD GLKRGPWTPD EDEILVNYIN KNKGHGSWRS LPQHAGLLRC GKSCRLRWTN  60
YLRPDIKRGP FTEEEEKLII QLHGMLGNRW AAIASQLPGR TDNEIKNLWN THLRKRLIRM  120
GINPQNHEPF TPDGSTSKTS ASTTTRHMAQ WESARLEAEA RLSRESSQFS TPFLEKSDSD  180
YFLRLWYSEV GESFRKLPIA GKTPSDSPIS EASSSGKCGS ISAVTTEIGH CFMGSSTMAA  240
TQDEDVKYKV IKSVTGEDMI YRIYKCNTEN VMIRGSDSSS SNKLDDSSES AMDMLLDYPI  300
NNDMSFLEDD MNDYATSTSA KIENAFFPLS DSKQAFKLLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285600.0FR828560.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb9 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306804.10.0PREDICTED: transcription repressor MYB6
TrEMBLF2QKY00.0F2QKY0_R
STRINGPOPTR_0014s07700.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-109myb domain protein 17